PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G019400.1.p
Common NameGLYMA_15G019400, MYB52
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 361aa    MW: 39229.1 Da    PI: 8.9001
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G019400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.2e-13115159347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
  Glyma.15G019400.1.p 115 PWTEEEHRLFLIGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKY 159
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.98108164IPR017930Myb domain
SuperFamilySSF466898.97E-17110164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-18111163IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-11112158IPR009057Homeodomain-like
SMARTSM007172.6E-10112162IPR001005SANT/Myb domain
CDDcd001675.90E-9115160No hitNo description
PfamPF002496.7E-11115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MTRRCSHCTN NGHNSRTCPS RGGGGVKLFG VRLTDGSIIK KSASMGNLNL SSSSSSAAAA  60
HLQFRSSPSS SNLPAASSPN PSSPCSDPPQ GYLSDDPAHV STFANRRGDR KKGVPWTEEE  120
HRLFLIGLQK LGKGDWRGIA RNFVVSRTPT QVASHAQKYF IRQSHATRRK RRSSLFDMVP  180
DMSSDQPSVP EEQVLLPPPE NSQPCNGKSQ PSLNLSLKSE FEPMETTSQE NVQQTNEPMM  240
GSNRLTPMAP HGCFPAYLPV PFPVWPSTWV HPFEEVKGGE TCHHQIHKPI PVIPKEPVNV  300
DELVGMSHLS IGEAQVRDRE PSPLSIKLLG EPSRQSAFHA NVPVGSSDLN NGKDNAIQAV  360
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286180.0hypocotyl| leaf| root| seed coat| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-158AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235649.10.0MYB transcription factor MYB52
TrEMBLQ0PJL80.0Q0PJL8_SOYBN; MYB transcription factor MYB52
STRINGGLYMA15G02250.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-100MYB_related family protein